PDB entry 1ev0

View 1ev0 on RCSB PDB site
Description: solution structure of the mine topological specificity domain
Class: cell cycle
Keywords: MinE, topological specificity, cell division, MinCD, minicell, CELL CYCLE
Deposited on 2000-04-19, released 2000-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mine
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev0a_
  • Chain 'B':
    Compound: mine
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ev0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev0A (A:)
    rsdaephylpqlrkdilevickyvqidpemvtvqleqkdgdisilelnvtlpeaeelk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ev0B (B:)
    rsdaephylpqlrkdilevickyvqidpemvtvqleqkdgdisilelnvtlpeaeelk