PDB entry 1esr

View 1esr on RCSB PDB site
Description: crystal structure of human monocyte chemotactic protein-2
Deposited on 2000-04-10, released 2000-12-06
The last revision prior to the SCOP 1.59 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.244
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1esra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1esrA (A:)
  epdsvsipitccfnvinrkipiqrlesytritniqcpkeavifktqrgkevcadpkerwv
  rdsmkhldqifqnlkp