PDB entry 1eqb

View 1eqb on RCSB PDB site
Description: x-ray crystal structure at 2.7 angstroms resolution of ternary complex between the y65f mutant of e-coli serine hydroxymethyltransferase, glycine and 5-formyl tetrahydrofolate
Class: transferase
Keywords: Functional mutant, hydroxymethyltransferase, aat-like fold, one carbon metabolism, TRANSFERASE
Deposited on 2000-04-03, released 2000-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.20500000000000002
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00477 (Start-416)
      • engineered (64)
    Domains in SCOPe 2.08: d1eqba_
  • Chain 'B':
    Compound: serine hydroxymethyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00477 (0-416)
      • engineered (64)
    Domains in SCOPe 2.08: d1eqbb_
  • Chain 'C':
    Compound: serine hydroxymethyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00477 (0-416)
      • engineered (64)
    Domains in SCOPe 2.08: d1eqbc_
  • Chain 'D':
    Compound: serine hydroxymethyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00477 (0-416)
      • engineered (64)
    Domains in SCOPe 2.08: d1eqbd_
  • Heterogens: GLY, PLP, FFO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eqbA (A:)
    mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
    gkryfggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
    lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
    vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
    akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
    vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
    girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eqbA (A:)
    lkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegypg
    kryfggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmnl
    ahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgvv
    dwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglila
    kggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamvev
    flergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvtsg
    irvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqbB (B:)
    mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
    gkryfggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
    lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
    vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
    akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
    vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
    girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqbC (C:)
    mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
    gkryfggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
    lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
    vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
    akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
    vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
    girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eqbD (D:)
    mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
    gkryfggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
    lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
    vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
    akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
    vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
    girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya