Lineage for d1eqbb_ (1eqb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131911Protein Serine hydroxymethyltransferase [53429] (6 species)
  7. 2131954Species Escherichia coli [TaxId:562] [53433] (2 PDB entries)
  8. 2131960Domain d1eqbb_: 1eqb B: [34485]
    complexed with ffo, gly, plp; mutant

Details for d1eqbb_

PDB Entry: 1eqb (more details), 2.7 Å

PDB Description: x-ray crystal structure at 2.7 angstroms resolution of ternary complex between the y65f mutant of e-coli serine hydroxymethyltransferase, glycine and 5-formyl tetrahydrofolate
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d1eqbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqbb_ c.67.1.4 (B:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]}
mlkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegyp
gkryfggceyvdiveqlaidrakelfgadyanvqphsgsqanfavytallepgdtvlgmn
lahgghlthgspvnfsgklynivpygidatghidyadlekqakehkpkmiiggfsaysgv
vdwakmreiadsigaylfvdmahvaglvaagvypnpvphahvvtttthktlagprgglil
akggseelykklnsavfpggqggplmhviagkavalkeamepefktyqqqvaknakamve
vflergykvvsggtdnhlflvdlvdknltgkeadaalgranitvnknsvpndpkspfvts
girvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya

SCOPe Domain Coordinates for d1eqbb_:

Click to download the PDB-style file with coordinates for d1eqbb_.
(The format of our PDB-style files is described here.)

Timeline for d1eqbb_: