PDB entry 1emr

View 1emr on RCSB PDB site
Description: crystal structure of human leukemia inhibitory factor (lif)
Class: gene regulation
Keywords: 4-helix bundle
Deposited on 2000-03-17, released 2001-03-21
The last revision prior to the SCOP 1.75 freeze date was dated 2001-03-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.191
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leukemia inhibitory factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15018 (0-158)
      • conflict (35)
      • conflict (150)
      • conflict (152)
    Domains in SCOP 1.75: d1emra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1emrA (A:)
lmnqirsqlaqlngsanalfilyytaqgepfpnnleklcgpnvtdfppfhangtekaklv
elyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlcrlcskyhvgh
vdvtygpdtsgkdvfqkkklgcqllgkykqvisvlaqaf