PDB entry 1emr

View 1emr on RCSB PDB site
Description: crystal structure of human leukemia inhibitory factor (lif)
Deposited on 2000-03-17, released 2001-03-21
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-21, with a file datestamp of 2001-03-21.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.191
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1emra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1emrA (A:)
lmnqirsqlaqlngsanalfilyytaqgepfpnnleklcgpnvtdfppfhangtekaklv
elyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlcrlcskyhvgh
vdvtygpdtsgkdvfqkkklgcqllgkykqvisvlaqaf