PDB entry 1emi

View 1emi on RCSB PDB site
Description: structure of 16s rrna in the region around ribosomal protein s8.
Deposited on 2000-03-16, released 2000-06-12
The last revision prior to the SCOP 1.59 freeze date was dated 2000-06-19, with a file datestamp of 2000-06-19.
Experiment type: XRAY
Resolution: 7.5 Å
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1emia_
  • Chain 'B':
    Domains in SCOP 1.59: d1emib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1emiA (A:)
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

  • Chain 'B':
    No sequence available.