PDB entry 1el8

View 1el8 on RCSB PDB site
Description: complex of monomeric sarcosine oxidase with the inhibitor [methylseleno]cetate
Class: oxidoreductase
Keywords: flavoprotein, oxidase, OXIDOREDUCTASE
Deposited on 2000-03-13, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sarcosine oxidase
    Species: Bacillus sp. [TaxId:69000]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1el8a1, d1el8a2
  • Chain 'B':
    Compound: sarcosine oxidase
    Species: Bacillus sp. [TaxId:69000]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1el8b1, d1el8b2
  • Heterogens: PO4, CL, FAD, MSF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1el8A (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqktti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1el8A (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1el8B (B:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqktti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1el8B (B:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslq