PDB entry 1eio

View 1eio on RCSB PDB site
Description: ileal lipid binding protein in complex with glycocholate
Class: lipid-binding protein
Keywords: bile acid binding, protein-ligand interaction, LIPID-BINDING PROTEIN
Deposited on 2000-02-27, released 2000-05-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ileal lipid binding protein
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10289 (0-126)
    • conflict (117)
  Domains in SCOPe 2.02: d1eioa_
• Heterogens: GCH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eioA (A:)
  aftgkyeieseknydefmkrlalpsdaidkarnlkiisevkqdgqnftwsqqypgghsit
  ntftigkecdietiggkkfkatvqmeggkvvvnspnyhhtaeivdgklvevstvggvsye
  rvskkla