PDB entry 1ehc

View 1ehc on RCSB PDB site
Description: structure of signal transduction protein chey
Deposited on 1996-03-05, released 1997-05-15
The last revision prior to the SCOP 1.63 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.143
AEROSPACI score: -1.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1ehc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ehc_ (-)
adkelkflvvdkfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm