PDB entry 1egr

View 1egr on RCSB PDB site
Description: sequence-specific 1h n.m.r. assignments and determination of the three-dimensional structure of reduced escherichia coli glutaredoxin
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1egr__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1egr_ (-)
  mqtvifgrsgcpycvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
  qifvdqqhiggytdfaawvkenlda