PDB entry 1ef4

View 1ef4 on RCSB PDB site
Description: solution structure of the essential RNA polymerase subunit rpb10 from methanobacterium thermoautotrophicum
Class: transferase
Keywords: THREE HELIX BUNDLE, ZINC BINDING, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSFERASE
Deposited on 2000-02-07, released 2000-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ef4a_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ef4A (A:)
    mipvrclscgkpvsayfneyqrrvadgedpkdvlddlglkryccrrmlishvetw