Lineage for d1ef4a_ (1ef4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695676Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 2695677Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 2695678Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 2695713Species Methanobacterium thermoautotrophicum [TaxId:145262] [46927] (1 PDB entry)
  8. 2695714Domain d1ef4a_: 1ef4 A: [16272]
    complexed with zn

Details for d1ef4a_

PDB Entry: 1ef4 (more details)

PDB Description: solution structure of the essential rna polymerase subunit rpb10 from methanobacterium thermoautotrophicum
PDB Compounds: (A:) DNA-directed RNA polymerase

SCOPe Domain Sequences for d1ef4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef4a_ a.4.11.1 (A:) RNA polymerase subunit RPB10 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mipvrclscgkpvsayfneyqrrvadgedpkdvlddlglkryccrrmlishvetw

SCOPe Domain Coordinates for d1ef4a_:

Click to download the PDB-style file with coordinates for d1ef4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ef4a_: