SCOPe 2.08: Domain d1ef4a_: 1ef4 A:

Lineage for d1ef4a_ (1ef4 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)
   automatically mapped to Pfam PF01194

5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
   Zn-binding site is near the N-terminus

6. Protein RNA polymerase subunit RPB10 [46926] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [46927] (1 PDB entry)

8. Domain d1ef4a_: 1ef4 A: [16272]
   complexed with zn

Details for d1ef4a_

PDB Entry: 1ef4

PDB Description: solution structure of the essential rna polymerase subunit rpb10 from methanobacterium thermoautotrophicum

PDB Compounds: (A:) DNA-directed RNA polymerase

SCOPe Domain Sequences for d1ef4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ef4a_ a.4.11.1 (A:) RNA polymerase subunit RPB10 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mipvrclscgkpvsayfneyqrrvadgedpkdvlddlglkryccrrmlishvetw

Timeline for d1ef4a_:

• d1ef4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ef4a_ appears in SCOPe 2.07