PDB entry 1ee8

View 1ee8 on RCSB PDB site
Description: crystal structure of mutm (fpg) protein from thermus thermophilus hb8
Class: DNA binding protein
Keywords: BETA SANDWICH, ZINC FINGER, HELIX TWO-TURNS HELIX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2000-01-31, released 2001-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mutm (fpg) protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ee8a1, d1ee8a2, d1ee8a3
  • Chain 'B':
    Compound: mutm (fpg) protein
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ee8b1, d1ee8b2, d1ee8b3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee8A (A:)
    pelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleg
    gvelvahlgmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllr
    lgpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpar
    slteeearrlyralrevlaeavelggstlsdqsyrqpdglpggfqtrhavygreglpcpa
    cgrpverrvvagrgthfcptcqgegp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ee8B (B:)
    pelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleg
    gvelvahlgmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllr
    lgpeplseafafpgffrglkesarplkallldqrlaagvgniyadealfrarlspfrpar
    slteeearrlyralrevlaeavelggstlsdqsyrqpdglpggfqtrhavygreglpcpa
    cgrpverrvvagrgthfcptcqgegp