Lineage for d1ee8a2 (1ee8 A:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821188Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2821189Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) (S)
    automatically mapped to Pfam PF01149
  5. 2821190Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins)
  6. 2821191Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 2821230Species Thermus thermophilus [TaxId:274] [81609] (1 PDB entry)
  8. 2821231Domain d1ee8a2: 1ee8 A:1-121 [75824]
    Other proteins in same PDB: d1ee8a1, d1ee8a3, d1ee8b1, d1ee8b3
    complexed with zn

Details for d1ee8a2

PDB Entry: 1ee8 (more details), 1.9 Å

PDB Description: crystal structure of mutm (fpg) protein from thermus thermophilus hb8
PDB Compounds: (A:) mutm (fpg) protein

SCOPe Domain Sequences for d1ee8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee8a2 b.113.1.1 (A:1-121) DNA repair protein MutM (Fpg) {Thermus thermophilus [TaxId: 274]}
pelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleg
gvelvahlgmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllr
l

SCOPe Domain Coordinates for d1ee8a2:

Click to download the PDB-style file with coordinates for d1ee8a2.
(The format of our PDB-style files is described here.)

Timeline for d1ee8a2: