PDB entry 1edl

View 1edl on RCSB PDB site
Description: staphylococcal protein a e-domain (-60), nmr, 22 structures
Deposited on 1996-07-22, released 1997-04-01
The last revision prior to the SCOP 1.59 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1edl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1edl_ (-)
    aqhdeaqqnafyqvlnmpnlnadqrngfiqslkddpsqsanvlgeaqklndsqapk