PDB entry 1ecy

View 1ecy on RCSB PDB site
Description: protease inhibitor ecotin
Deposited on 1996-08-06, released 1997-02-12
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-02, with a file datestamp of 1999-12-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ecy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ecy_ (-)
aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
dnvdvkyrvwkaeekidnavvr