Lineage for d1ecy__ (1ecy -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) 
Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein) Protein Ecotin, trypsin inhibitor [49774] (1 species) Species Escherichia coli [TaxId:562] [49775] (12 PDB entries) 
Domain d1ecy__: 1ecy - [23697]
Details for d1ecy__
PDB Entry: 1ecy (more details), 2.19 Å
PDB Description: protease inhibitor ecotin
SCOP Domain Sequences for d1ecy__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecy__ b.16.1.1 (-) Ecotin, trypsin inhibitor {Escherichia coli}
aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
dnvdvkyrvwkaeekidnavvr
SCOP Domain Coordinates for d1ecy__:
Click to download the PDB-style file with coordinates for d1ecy__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ecy__:
- d1ecy__ first appeared (with stable ids) in SCOP 1.55
- d1ecy__ appears in SCOP 1.59
- d1ecy__ appears in the current release, SCOPe 2.08, called d1ecya_
View in 3D