PDB entry 1eaj

View 1eaj on RCSB PDB site
Description: dimeric structure of the coxsackie virus and adenovirus receptor d1 domain at 1.35 angstrom resolution
Deposited on 2001-07-12, released 2001-07-13
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-13, with a file datestamp of 2001-07-13.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.13708
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1eaja_
  • Chain 'B':
    Domains in SCOP 1.57: d1eajb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eajA (A:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvlv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eajB (B:)
    lsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdki
    yddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlv