Lineage for d1eaja_ (1eaj A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51688Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 51689Species Human (Homo sapiens) [TaxId:9606] [48731] (3 PDB entries)
  8. 51690Domain d1eaja_: 1eaj A: [59401]

Details for d1eaja_

PDB Entry: 1eaj (more details), 1.35 Å

PDB Description: dimeric structure of the coxsackie virus and adenovirus receptor d1 domain at 1.35 angstrom resolution

SCOP Domain Sequences for d1eaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens)}
farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
vvlv

SCOP Domain Coordinates for d1eaja_:

Click to download the PDB-style file with coordinates for d1eaja_.
(The format of our PDB-style files is described here.)

Timeline for d1eaja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eajb_