PDB entry 1e8e

View 1e8e on RCSB PDB site
Description: solution structure of methylophilus methylotrophus cytochrome c''. insights into the structural basis of haem-ligand detachment
Deposited on 2000-09-20, released 2001-09-20
The last revision prior to the SCOP 1.63 freeze date was dated 2001-09-20, with a file datestamp of 2001-09-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1e8ea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1e8eA (A:)
  dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
  gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
  kptk