PDB entry 1e8e

View 1e8e on RCSB PDB site
Description:
Deposited on 2000-09-20, released 2001-09-20
The last revision prior to the SCOP 1.63 freeze date was dated 2001-09-20, with a file datestamp of 2001-09-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1e8ea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e8eA (A:)
    dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
    gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
    kptk