PDB entry 1e7v

View 1e7v on RCSB PDB site
Description: Structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, LY294002, quercetin, myricetin and staurosporine
Class: transferase
Keywords: transferase, secondary messenger generation pi3k, pi 3k, ly294002
Deposited on 2000-09-08, released 2000-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.273
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase catalytic subunit
    Species: SUS SCROFA [TaxId:9823]
    Gene: P120S144C
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02697 (2-End)
      • expression tag (1)
      • conflict (363)
    Domains in SCOPe 2.06: d1e7va1, d1e7va2, d1e7va3, d1e7va4, d1e7va5
  • Heterogens: LY2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7vA (A:)
    aaseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpw
    vtskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmakkkslmdi
    pesqnerdfvlrvcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrke
    ewplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprtadltv
    fveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapal
    sgktsaempspeskgkaqllyyvnlllidhrfllrhgeyvlhmwqlsgkgedqgsfnadk
    ltsatnpdkensmsisilldnychpialpkhrptpdpegdrvraempnqlrkqleaiiat
    dplnpltaedkellwhfryeslkdpkaypklfssvkwgqqeivaktyqllakrevwdqsa
    ldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfl
    lkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvidm
    lqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrvpydpglkagalviekc
    kvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesld
    lcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlshwlkekcpieekf
    qaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidfghilgnyksflginke
    rvpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmpq
    ltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7vA (A:)
    aseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpwv
    tskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmadfvlrvcgr
    deylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrkelwdcdrkfrvkirgid
    ipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgall
    nlqiycqllyyvnlllidhrfllrhgeyvlhmwqlsfnadkltsatnpdkensmsisill
    dnychpialpkempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfs
    svkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledd
    dvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfa
    vileaylrgcgtamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenl
    qnlnlpqsfrvpydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkh
    gddlrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqs
    tvgntgafkdevlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimi
    setgnlfhidfghinkervpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhht
    nlliilfsmmlmtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqf
    nwflhlvlgi