PDB entry 1e7n

View 1e7n on RCSB PDB site
Description: the n-terminal domain of beta-b2-crystallin resembles the putative ancestral homodimer
Class: structural protein
Keywords: structural protein, eye lens protein, domain interactions, 2-fold symmetry
Deposited on 2000-08-31, released 2000-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-crystallin b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7na_
  • Chain 'B':
    Compound: beta-crystallin b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e7nb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7nA (A:)
    asdhqtqagkpqplnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvg
    yeqanckgeqfvfekgeyprwdswtssrrtdslsslrpikvdsqeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7nA (A:)
    lnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvgyeqanckgeqfvf
    ekgeyprwdswtssrrtdslsslrpikvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e7nB (B:)
    asdhqtqagkpqplnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvg
    yeqanckgeqfvfekgeyprwdswtssrrtdslsslrpikvdsqeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7nB (B:)
    lnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvgyeqanckgeqfvf
    ekgeyprwdswtssrrtdslsslrpikvd