Lineage for d1e7nb_ (1e7n B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773467Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2773486Species Mouse (Mus musculus) [TaxId:10090] [49705] (1 PDB entry)
  8. 2773488Domain d1e7nb_: 1e7n B: [23621]
    N-terminal domain only

Details for d1e7nb_

PDB Entry: 1e7n (more details), 2.35 Å

PDB Description: the n-terminal domain of beta-b2-crystallin resembles the putative ancestral homodimer
PDB Compounds: (B:) beta-crystallin b2

SCOPe Domain Sequences for d1e7nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7nb_ b.11.1.1 (B:) beta-Crystallin {Mouse (Mus musculus) [TaxId: 10090]}
lnpkiiifeqenfqghshelsgpcpnlketgmekagsvlvqagpwvgyeqanckgeqfvf
ekgeyprwdswtssrrtdslsslrpikvd

SCOPe Domain Coordinates for d1e7nb_:

Click to download the PDB-style file with coordinates for d1e7nb_.
(The format of our PDB-style files is described here.)

Timeline for d1e7nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e7na_