PDB entry 1e51

View 1e51 on RCSB PDB site
Description: Crystal structure of native human erythrocyte 5-aminolaevulinic acid dehydratase
Class: lyase
Keywords: dehydratase, tetrapyrrole biosynthesis, tim barrel, porphobilinogen synthase, lead poisoning, lyase
Deposited on 2000-07-13, released 2001-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.213
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e51a_
  • Chain 'B':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e51b_
  • Heterogens: PBG, ZN, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e51A (A:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
    almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
    dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
    leamtafrragadiiityytpqllqwlkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e51A (A:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsgafraeesrqrlaevalayakagcqvvapsdmmdgrveaikeal
    mahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdrdv
    regadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaavle
    amtafrragadiiityytpqllqwlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e51B (B:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
    vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
    almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
    dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
    leamtafrragadiiityytpqllqwlkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e51B (B:)
    mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
    leemlrplveeglrcvlifgvpsrvpkdadseespaieaihllrktfpnllvacdvclcp
    yaeesrqrlaevalayakagcqvvapsdmmdgrveaikealmahglgnrvsvmsysakfa
    scfygpfrdaarrcyqlppgarglalravdrdvregadmlmvkpgmpyldivrevkdkhp
    dlplavyhvsgefamlwhgaqagafdlkaavleamtafrragadiiityytpqllqwlk