Lineage for d1e51b_ (1e51 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086002Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 protein domains)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2086003Protein 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51595] (5 species)
  7. 2086025Species Human (Homo sapiens) [TaxId:9606] [63921] (4 PDB entries)
  8. 2086029Domain d1e51b_: 1e51 B: [59255]
    complexed with pbg, so4, zn

Details for d1e51b_

PDB Entry: 1e51 (more details), 2.83 Å

PDB Description: Crystal structure of native human erythrocyte 5-aminolaevulinic acid dehydratase
PDB Compounds: (B:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d1e51b_:

Sequence, based on SEQRES records: (download)

>d1e51b_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]}
mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
leemlrplveeglrcvlifgvpsrvpkdergsaadseespaieaihllrktfpnllvacd
vclcpytshghcgllsengafraeesrqrlaevalayakagcqvvapsdmmdgrveaike
almahglgnrvsvmsysakfascfygpfrdaaksspafgdrrcyqlppgarglalravdr
dvregadmlmvkpgmpyldivrevkdkhpdlplavyhvsgefamlwhgaqagafdlkaav
leamtafrragadiiityytpqllqwlk

Sequence, based on observed residues (ATOM records): (download)

>d1e51b_ c.1.10.3 (B:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]}
mqpqsvlhsgyfhpllrawqtatttlnasnliypifvtdvpddiqpitslpgvarygvkr
leemlrplveeglrcvlifgvpsrvpkdadseespaieaihllrktfpnllvacdvclcp
yaeesrqrlaevalayakagcqvvapsdmmdgrveaikealmahglgnrvsvmsysakfa
scfygpfrdaarrcyqlppgarglalravdrdvregadmlmvkpgmpyldivrevkdkhp
dlplavyhvsgefamlwhgaqagafdlkaavleamtafrragadiiityytpqllqwlk

SCOPe Domain Coordinates for d1e51b_:

Click to download the PDB-style file with coordinates for d1e51b_.
(The format of our PDB-style files is described here.)

Timeline for d1e51b_: