PDB entry 1e4h

View 1e4h on RCSB PDB site
Description: structure of human transthyretin complexed with bromophenols: a new mode of binding
Deposited on 2000-07-04, released 2000-08-29
The last revision prior to the SCOP 1.61 freeze date was dated 2000-08-29, with a file datestamp of 2000-08-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1e4ha_
  • Chain 'B':
    Domains in SCOP 1.61: d1e4hb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e4hA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e4hB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp