PDB entry 1e44

View 1e44 on RCSB PDB site
Description: ribonuclease domain of colicin e3 in complex with its immunity protein
Class: ribonuclease
Keywords: ribonuclease, inhibition, protein-protein interactions, ribosome inactivation, toxin
Deposited on 2000-06-28, released 2001-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunity protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e44a_
  • Chain 'B':
    Compound: Colicin E3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e44b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e44A (A:)
    mglkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllq
    pyfnhqidisdneyfvsfdyrdgdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e44A (A:)
    glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
    yfnhqidisdneyfvsfdyrdgdw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e44B (B:)
    gfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkgrkiyewdsqhge
    legyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl