SCOPe 2.08: Domain d1e44b_: 1e44 B:

Lineage for d1e44b_ (1e44 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.101: Ribonuclease domain of colicin E3 [63839] (1 superfamily)
   twisted meander beta-sheet of 6 strands

4. Superfamily b.101.1: Ribonuclease domain of colicin E3 [63840] (1 family)
   automatically mapped to Pfam PF09000

5. Family b.101.1.1: Ribonuclease domain of colicin E3 [63841] (2 proteins)

6. Protein Ribonuclease domain of colicin E3 [63842] (1 species)

7. Species Escherichia coli [TaxId:562] [63843] (3 PDB entries)

8. Domain d1e44b_: 1e44 B: [59220]
   Other proteins in same PDB: d1e44a_
   complexed with edo

Details for d1e44b_

PDB Entry: 1e44, 2.4 Å

PDB Description: ribonuclease domain of colicin e3 in complex with its immunity protein

PDB Compounds: (B:) Colicin E3

SCOPe Domain Sequences for d1e44b_:

Sequence; same for both SEQRES and ATOM records:

>d1e44b_ b.101.1.1 (B:) Ribonuclease domain of colicin E3 {Escherichia coli [TaxId: 562]}
gfkdyghdyhpapktenikglgdlkpgipktpkqngggkrkrwtgdkgrkiyewdsqhge
legyrasdgqhlgsfdpktgnqlkgpdpkrnikkyl

Timeline for d1e44b_:

• d1e44b_ first appeared in SCOP 1.57
  
• d1e44b_ appears in SCOPe 2.07