PDB entry 1e3p

View 1e3p on RCSB PDB site
Description: tungstate derivative of streptomyces antibioticus pnpase/ gpsi enzyme
Class: polyribonucleotide transferase
Keywords: polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation
Deposited on 2000-06-20, released 2000-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: -1.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanosine pentaphosphate synthetase
    Species: STREPTOMYCES ANTIBIOTICUS [TaxId:1890]
    Gene: GPSI
    Database cross-references and differences (RAF-indexed):
    • PDB 1E3P
      • sequencing ambiguity (47)
      • sequencing ambiguity (172)
      • sequencing ambiguity (226)
      • sequencing ambiguity (276-281)
      • sequencing ambiguity (283-285)
      • sequencing ambiguity (339-342)
      • sequencing ambiguity (344-346)
      • sequencing ambiguity (351)
      • sequencing ambiguity (425)
    • Uniprot Q53597 (Start-681)
    Domains in SCOPe 2.07: d1e3pa1, d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7
  • Heterogens: SO4, WO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e3pA (A:)
    asmtggqqmgrgsgsefmenethyaeavidngafgtrtirfetgrlarqaagsavayldd
    dtmvlsattasknpkdqldffpltvdveermyaagkipgsffrregrpsedailtcrlid
    rplrpsfkkglrneiqvvatimalnpdhlydvvainaasastqlaglpfsgpiggvrval
    irgqwvafpthteledavfdmvvagrvledgdvaimmveaeatektiqlvkdgaeaptee
    vvaagldaakpfikvlckaqadlaakaakptgefpvfldyqddvlealsaavrpelsaal
    tiagkqdreaeldrvkalaaekllpefegrekeisaayraltkslvrerviaekkridgr
    gvtdirtlaaeveaiprvhgsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhn
    ynfppysvgetgrvgspkrreighgalaeraivpvlptreefpyairqvsealgsngsts
    mgsvcastmsllnagvplkapvagiamglisqeingethyvaltdilgaedafgdmdfkv
    agtkefvtalqldtkldgipasvlaaalkqardarlhildvmmeaidtpdemspnaprii
    tvkipvdkigevigpkrqminqiqedtgaeitieddgtiyigaadgpaaeaaratingia
    nptspevgerilgsvvktttfgafvsllpgkdgllhisqirklaggkrvenvedvlgvgq
    kvqveiaeidsrgklslipviegeeaasdekkddaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e3pA (A:)
    nethyaeavidngafgtrtirfetgrlarqaagsavayldddtmvlsattasknpkdqld
    ffpltvdveermyaagkipgsffrregrpsedailtcrlidrplrpsfkkglrneiqvva
    timalnpdhlydvvainaasastqlaglpfsgpiggvrvalirgqwvafpthteledavf
    dmvvagrvledgdvaimmveaeatektiqlvkdgaeapteevvaagldaakpfikvlcka
    qadlaakaakptgefpvfldyqddvlealsaavrpelsaaltiagkqdreaeldrvkala
    aekllpefegrekeisaayraltkslvrerviaekkridgrgvtdirtlaaeveaiprvh
    gsalfergetqilgvttlnmlrmeqqldtlspvtrkrymhnynfppysvgetgrvgspkr
    reighgalaeraivpvlptreefpyairqvsealgsngstsmgsvcastmsllnagvplk
    apvagiamglisqeingethyvaltdilgaedafgdmdfkvagtkefvtalqldtkldgi
    pasvlaaalkqardarlhildvmmeaidtpdemspnapriitvnqiqedtgaeiyigaad
    gpaaeagsvvkttfgafvslldgllhlgvgqkvqveiaeidsrgk