PDB entry 1e26

View 1e26 on RCSB PDB site
Description: design, synthesis and x-ray crystal structure of a potent dual inhibitor of thymidylate synthase and dihydrofolate reductase as an antitumor agent.
Deposited on 2000-05-17, released 2001-05-17
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-17, with a file datestamp of 2001-05-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1e26a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1e26A (A:)
nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
gtkvphgkinedgfdyefemwtrdl