Lineage for d1e26a_ (1e26 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74023Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 74024Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 74025Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 74110Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 74120Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (8 PDB entries)
  8. 74124Domain d1e26a_: 1e26 A: [59160]

Details for d1e26a_

PDB Entry: 1e26 (more details), 2 Å

PDB Description: design, synthesis and x-ray crystal structure of a potent dual inhibitor of thymidylate synthase and dihydrofolate reductase as an antitumor agent.

SCOP Domain Sequences for d1e26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e26a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii)}
nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
gtkvphgkinedgfdyefemwtrdl

SCOP Domain Coordinates for d1e26a_:

Click to download the PDB-style file with coordinates for d1e26a_.
(The format of our PDB-style files is described here.)

Timeline for d1e26a_: