PDB entry 1dzi

View 1dzi on RCSB PDB site
Description: integrin alpha2 I domain / collagen complex
Class: integrin
Keywords: integrin, collagen
Deposited on 2000-03-01, released 2001-03-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2729
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17301 (0-184)
      • conflict (0)
    Domains in SCOPe 2.02: d1dzia_
  • Chain 'B':
    Compound: collagen
    Database cross-references and differences (RAF-indexed):
    • PDB 1DZI (0-End)
    Domains in SCOPe 2.02: d1dzib_
  • Chain 'C':
    Compound: collagen
    Database cross-references and differences (RAF-indexed):
    • PDB 1DZI (0-End)
    Domains in SCOPe 2.02: d1dzic_
  • Chain 'D':
    Compound: collagen
    Database cross-references and differences (RAF-indexed):
    • PDB 1DZI (0-End)
    Domains in SCOPe 2.02: d1dzid_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dziA (A:)
    alidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyk
    tkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgs
    mlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaal
    lekag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dziB (B:)
    gppgppgfpgergppgppgpp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dziC (C:)
    gppgppgfpgergppgppgpp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dziD (D:)
    gppgppgfpgergppgppgpp