PDB entry 1dvz

View 1dvz on RCSB PDB site
Description: crystal structure of human transthyretin in complex with o-trifluoromethylphenyl anthranilic acid
Deposited on 2000-01-23, released 2001-01-23
The last revision prior to the SCOP 1.61 freeze date was dated 2001-01-23, with a file datestamp of 2001-01-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1dvza_
  • Chain 'B':
    Domains in SCOP 1.61: d1dvzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dvzA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dvzB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt