PDB entry 1dvq

View 1dvq on RCSB PDB site
Description: crystal structure of human transthyretin
Deposited on 2000-01-22, released 2001-01-22
The last revision prior to the SCOP 1.61 freeze date was dated 2001-01-22, with a file datestamp of 2001-01-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1dvqa_
  • Chain 'B':
    Domains in SCOP 1.61: d1dvqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dvqA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dvqB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt