PDB entry 1dv0

View 1dv0 on RCSB PDB site
Description: Refined NMR solution structure of the C-terminal UBA domain of the human homologue of RAD23A (HHR23A)
Class: DNA binding protein
Keywords: Helical bundle, DNA BINDING PROTEIN
Deposited on 2000-01-19, released 2000-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA repair protein hhr23a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54725 (2-46)
  Domains in SCOPe 2.07: d1dv0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1dv0A (A:)
  gsqekeaierlkalgfpeslviqayfaceknenlaanfllsqnfdde
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1dv0A (A:)
  qekeaierlkalgfpeslviqayfaceknenlaanfllsqnfdde