PDB entry 1duo

View 1duo on RCSB PDB site
Description: sperm whale metaquomyoglobin proximal histidine mutant h93g with 1-methylimidazole as proximal ligand.
Class: oxidoreductase
Keywords: Myoglobin, ligand substitution, heme protein, OXIDOREDUCTASE
Deposited on 2000-01-18, released 2000-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sperm whale metaquomyoglobin variant h93g
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-End)
      • engineered mutation (92)
    Domains in SCOPe 2.08: d1duoa_
  • Heterogens: HEM, 1MZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1duoA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

    Sequence, based on observed residues (ATOM records): (download) 
    >1duoA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyq