Lineage for d1duoa_ (1duo A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. Protein Myoglobin [46469] (10 species)
  7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
    Uniprot P02185
  8. Domain d1duoa_: 1duo A: [15137]
    complexed with 1mz, hem; mutant

Details for d1duoa_

PDB Entry: 1duo (more details), 2 Å

PDB Description: sperm whale metaquomyoglobin proximal histidine mutant h93g with 1- methylimidazole as proximal ligand.
PDB Compounds: (A:) sperm whale metaquomyoglobin variant h93g

SCOPe Domain Sequences for d1duoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duoa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyq

SCOPe Domain Coordinates for d1duoa_ are not available.

Timeline for d1duoa_: