PDB entry 1duc

View 1duc on RCSB PDB site
Description: eiav dutpase dudp/strontium complex
Class: hydrolase
Keywords: hydrolase, dutpase, eiav, trimeric enzyme, inhibitor complex, aspartyl protease
Deposited on 1997-11-29, released 1998-06-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.168
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Equine infectious anemia virus [TaxId:11665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1duca_
  • Heterogens: SR, DUD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ducA (A:)
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwdenki
sqrgdkgfgstgvf

    Sequence, based on observed residues (ATOM records): (download) 
    >1ducA (A:)
mlayqgtqikekrdedagfdlcvpydimipvsdtkiiptdvkiqvppnsfgwvtgkssma
kqgllinggiidegytgeiqvictnigksnikliegqkfaqliilqhhsnsrqpwden