PDB entry 1dtm

View 1dtm on RCSB PDB site
Description: crystal structure of the sperm-whale myoglobin mutant h93g complexed with 4-methylimidazole, metaquo form
Deposited on 2000-01-12, released 2000-02-07
The last revision prior to the SCOP 1.61 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.175
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1dtma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dtmA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqsgatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyq