PDB entry 1dt7

View 1dt7 on RCSB PDB site
Description: solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Deposited on 2000-01-11, released 2000-07-26
The last revision prior to the SCOP 1.61 freeze date was dated 2000-07-26, with a file datestamp of 2000-07-26.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1dt7a_
  • Chain 'B':
    Domains in SCOP 1.61: d1dt7b_
  • Chain 'X':
    Domains in SCOP 1.61: d1dt7x_
  • Chain 'Y':
    Domains in SCOP 1.61: d1dt7y_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dt7A (A:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dt7B (B:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dt7X (X:)
shlkskkgqstsrhkklmfkte

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dt7Y (Y:)
shlkskkgqstsrhkklmfkte