PDB entry 1dst

View 1dst on RCSB PDB site
Description: mutant of factor d with enhanced catalytic activity
Class: hydrolase (serine protease)
Keywords: complement activating enzyme, hydrolase, serine protease, factor d, hydrolase (serine protease)
Deposited on 1995-09-13, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00746 (0-227)
      • engineered (80)
      • engineered (197-198)
    Domains in SCOPe 2.07: d1dsta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dstA (A:)
    ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
    sqpepskrlydvlravphpdyqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
    tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
    gdsggplvcggvlegvvswgsrvcgnrkkpgiytrvasyaawidsvla