PDB entry 1dqc

View 1dqc on RCSB PDB site
Description: solution structure of tachycitin, an antimicrobial protein with chitin-binding function
Class: antimicrobial protein
Keywords: disulfide-rich
Deposited on 2000-01-04, released 2000-09-13
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tachycitin
    Species: Tachypleus tridentatus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dqca_
  • Heterogens: NH2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dqcA (A:)
ylafrcgryspclddgpnvnlysccsfynchkclarlencpkglhynaylkvcdwpskag
ctsvnkechlwkt