SCOP 1.73: Domain d1dqca_: 1dqc A:

Lineage for d1dqca_ (1dqc A:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.31: Invertebrate chitin-binding proteins [57624] (1 superfamily)
   disulfide-rich

4. Superfamily g.31.1: Invertebrate chitin-binding proteins [57625] (2 families)
   shares a putative chitin-binding motif with the plant lectins/antimicrobial peptides superfamily but lacks one of the conserved disulfides of the knottin fold

5. Family g.31.1.1: Tachycitin [57626] (1 protein)

6. Protein Tachycitin [57627] (1 species)
   an antimicrobial protein with chitin-binding function

7. Species Horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [57628] (1 PDB entry)

8. Domain d1dqca_: 1dqc A: [44964]
   complexed with nh2

Details for d1dqca_

PDB Entry: 1dqc

PDB Description: solution structure of tachycitin, an antimicrobial protein with chitin-binding function

PDB Compounds: (A:) tachycitin

SCOP Domain Sequences for d1dqca_:

Sequence; same for both SEQRES and ATOM records:

>d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]}
ylafrcgryspclddgpnvnlysccsfynchkclarlencpkglhynaylkvcdwpskag
ctsvnkechlwkt

Timeline for d1dqca_:

• d1dqca_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqca_ appears in SCOP 1.71
  
• d1dqca_ appears in SCOP 1.75
  
• d1dqca_ appears in the current release, SCOPe 2.08