PDB entry 1dqb

View 1dqb on RCSB PDB site
Description: nmr structure of thrombomodulin egf(4-5)
Deposited on 2000-01-03, released 2000-03-06
The last revision prior to the SCOP 1.59 freeze date was dated 2000-03-06, with a file datestamp of 2000-03-06.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1dqba1, d1dqba2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dqbA (A:)
  hmepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcqmfcnqtacpadcdpnt
  qascecpegyilddgfictdide