PDB entry 1dq6

View 1dq6 on RCSB PDB site
Description: Manganese;Manganese concanavalin A at pH 7.0
Class: sugar binding protein
Keywords: concanavalin A, lectin, metal binding, manganese, binuclear, SUGAR BINDING PROTEIN
Deposited on 1999-12-30, released 2000-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese;manganese concanavalin a (ph 7.0)
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • see remark 999 (150)
      • see remark 999 (154)
    Domains in SCOPe 2.06: d1dq6a_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dq6A (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan