PDB entry 1dof

View 1dof on RCSB PDB site
Description: the crystal structure of adenylosuccinate lyase from pyrobaculum aerophilum: insights into thermal stability and human pathology
Class: lyase
Keywords: purine biosynthesis, lyase
Deposited on 1999-12-20, released 2001-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate lyase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dofa_
  • Chain 'B':
    Compound: adenylosuccinate lyase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dofb_
  • Chain 'C':
    Compound: adenylosuccinate lyase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dofc_
  • Chain 'D':
    Compound: adenylosuccinate lyase
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dofd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dofA (A:)
    mhvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsa
    devyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekar
    avgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirak
    iggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferl
    aveirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwhe
    rdltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnr
    mikegasraeaykkakevkaltfeyqkwpverliedalslklc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dofA (A:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
    arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
    swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
    peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
    aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
    kaltfeyqkwpverliedalslklc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dofB (B:)
    mhvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsa
    devyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekar
    avgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirak
    iggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferl
    aveirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwhe
    rdltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnr
    mikegasraeaykkakevkaltfeyqkwpverliedalslklc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dofB (B:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
    arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
    swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
    peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
    aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
    kaltfeyqkwpverliedalslklc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dofC (C:)
    mhvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsa
    devyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekar
    avgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirak
    iggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferl
    aveirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwhe
    rdltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnr
    mikegasraeaykkakevkaltfeyqkwpverliedalslklc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dofC (C:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
    arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
    swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
    peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
    aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
    kaltfeyqkwpverliedalslklc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dofD (D:)
    mhvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsa
    devyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekar
    avgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirak
    iggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferl
    aveirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwhe
    rdltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnr
    mikegasraeaykkakevkaltfeyqkwpverliedalslklc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dofD (D:)
    hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
    evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
    arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
    swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
    peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
    aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
    kaltfeyqkwpverliedalslklc