Lineage for d1dofc_ (1dof C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010266Protein Adenylosuccinate lyase [48568] (3 species)
  7. 2010269Species Pyrobaculum aerophilum [TaxId:13773] [48570] (1 PDB entry)
  8. 2010272Domain d1dofc_: 1dof C: [19431]

Details for d1dofc_

PDB Entry: 1dof (more details), 2.1 Å

PDB Description: the crystal structure of adenylosuccinate lyase from pyrobaculum aerophilum: insights into thermal stability and human pathology
PDB Compounds: (C:) adenylosuccinate lyase

SCOPe Domain Sequences for d1dofc_:

Sequence, based on SEQRES records: (download)

>d1dofc_ a.127.1.1 (C:) Adenylosuccinate lyase {Pyrobaculum aerophilum [TaxId: 13773]}
hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
evyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekara
vgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefiraki
ggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferla
veirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwher
dltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnrm
ikegasraeaykkakevkaltfeyqkwpverliedalslklc

Sequence, based on observed residues (ATOM records): (download)

>d1dofc_ a.127.1.1 (C:) Adenylosuccinate lyase {Pyrobaculum aerophilum [TaxId: 13773]}
hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
kaltfeyqkwpverliedalslklc

SCOPe Domain Coordinates for d1dofc_:

Click to download the PDB-style file with coordinates for d1dofc_.
(The format of our PDB-style files is described here.)

Timeline for d1dofc_: