PDB entry 1div

View 1div on RCSB PDB site
Description: ribosomal protein l9
Deposited on 1996-07-02, released 1997-01-11
The last revision prior to the SCOP 1.61 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1div_ (-)
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
elanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrkielada
iralgytnvpvklhpevtatlkvhvteqk