PDB entry 1dfa

View 1dfa on RCSB PDB site
Description: crystal structure of pi-scei in c2 space group
Class: hydrolase
Keywords: intein, homing endonuclease, hydrolase
Deposited on 1999-11-18, released 1999-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pi-scei endonuclease
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dfaa1, d1dfaa2, d1dfaa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dfaA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
    pilyendhffdymqkskfhltiegpkvlayllglwigdglsdratfsvdsrdtslmervt
    eyaeklnlcaeykdrkepqvaktvnlyskvvrgngirnnlntenplwdaivglgflkdgv
    knipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdglvslarslglv
    vsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapaaafarecrgfy
    felqelkeddyygitlsddsdhqfllanqvvvhn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dfaA (A:)
    cfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
    sdssrevpellkftcnathelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
    elvkevsksypisekayfewtieardlsllgshvrkatyqtyapilyendhffdymqlti
    egpkvlayllglwigdglsdratfsvdsrdtslmervteyaeklnlcaeykntenplwda
    ivglgflkdgvknipsflstdnigtretflaglidsdgyvtdehgikatiktihtsvrdg
    lvslarslglvvsvnaepakvdmngtkhkisyaiymsggdvllnvlskcagskkfrpapa
    aafarecrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn